DPCstruct | MC30636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 120 ± 18 aa |
| Standard deviation of domain lengths | 17.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 26.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L8B254 | 5-104 | QHQTHITAEMDAQHDVNKIIWLVAGLALNLIGILIAYIYQPPPPETRFFDKSDEFRLFYTEAYKSKARSIQLTYTLIGCIVPFGFVI… |
| A0A661AS78 | 31-151 | ILMLVVALGMAVLPAVLYAQEEACVEARMDAQREVNTGMWFAIGFFLGVVGWLIAYVMEPSPPAAKLIGADPEYVAVYTQCYKEEAK… |
| A0A660S9S5 | 23-155 | None |
| A0A532V6S8 | 5-132 | None |
| A0A7V8VW42 | 122-236 | None |
| A0A495ZFY4 | 1-161 | None |
| A0A660SGU2 | 1-102 | None |
| A0A7C7V9A9 | 13-124 | None |
| A0A7X3NYN9 | 8-131 | None |
| A0A7X3VMR2 | 2-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.