DPCstruct | MC30635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10337 |
|---|---|
| Mean domain length (aa) | 241 ± 51 aa |
| Standard deviation of domain lengths | 50.74 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.36 |
| Mean intra-cluster sequence similarity (%) | 13.03 |
| Pfam Score | 97.18 |
| Assigned Pfam label(s) | CL0418- PF06102- CL0113- CL0110- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1HQ95 | 2-187 | LRGYGTTRFLSASTPRNGQPSAMAADIVHLMDALNIRQADLAGFDWGARTADIVAALWPQRVKSLVSVSGYLISSQQIGEKPLPPQA… |
| A0A6B1EM21 | 8-252 | FYNKGQQLNGILHSPVACDTPCPAVVFFHGFTGTKVEPHRIFVKTARELAGAGFHALRFDFRGSGDSGGDFSEMTIGGEVSDAIKSI… |
| A0A7G6AAC6 | 10-276 | None |
| A0A1X6PEA1 | 425-713 | None |
| A0A1X6PFW9 | 77-321 | None |
| A0A1X6PL83 | 61-246 | None |
| A0A194UMT4 | 64-323 | None |
| A0A3B4FN40 | 52-287 | None |
| A0A194UQ39 | 488-686 | None |
| A0A7S4A031 | 35-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.