DPCstruct | MC30634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 307 ± 35 aa |
| Standard deviation of domain lengths | 35.34 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6RP91 | 2-277 | SQAGRAIAACAPVPADKCRLNGHGIAAAQMDQPDLGSVTVKDKGAAGTQSFTQVAAMLGSRSLPDEARLADVWASILEVSLWPLQST… |
| M4UDN5 | 144-520 | CSAYRTTDPAKYAWGRLKHYQNIDAVTQDIMELHNLPEKHRPNAKRQATQLRQCLLQAGEYFDAAKSVSLATRPVLLYYSIMSLALC… |
| A0A6L8MNL3 | 106-434 | None |
| A0A445MV44 | 3-256 | None |
| A0A6P2T8X5 | 190-519 | None |
| A0A1Q8BD84 | 2-335 | None |
| A0A3D2IEA8 | 60-377 | None |
| A0A1H5HQ89 | 2-287 | None |
| A0A7C1M1G2 | 1-232 | None |
| A0A7T2CSQ6 | 111-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.