DPCstruct | MC30633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 241 ± 24 aa |
| Standard deviation of domain lengths | 23.53 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.65 |
| Pfam Score | 65.00 |
| Assigned Pfam label(s) | PF18154- PF18156 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R1CS06 | 15-279 | LPYPSGVQRALDQVVLRCLNQGEAPPSGVPDLVRWCTKRVCADWPFGLPAGFVGLGASLVDARARMTTRMCAEVASDGPAGVVEQHA… |
| A0A2W6PNW7 | 1-245 | MLACLERGAEPPVSLPDLLSWCRERPVADWPVDLPAEAAGPDDLLLDPESSRPTELCYEWAEQFSDSALVLYDREIIRAALRLCREY… |
| A0A1H3FRS5 | 49-283 | None |
| A0A3Q9KFA8 | 2-246 | None |
| A0A378Y7Y8 | 37-275 | None |
| A0A388RSM7 | 9-244 | None |
| A0A317TIY6 | 7-201 | None |
| A0A396SCM3 | 79-363 | None |
| E4N2Y8 | 2-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.