DPCstruct | MC3063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 7.31 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I7UB33 | 102-203 | GYALAPVTWMLGARFLPVPGGEDGNAFDARVDDAVRQIADNGDENAVAFAHGATIMFWVMMNVDNPDLGLMLRHQLDNTESVVIDGS… |
| X8CBK2 | 17-105 | DRKDAIPGSIDGNRFNNEFSAAVQKIYDSGNSKPIAFSHGYAIMVWTLMNAKNGRDSLMTEHPLPVIGKVVLTGSPATGWTLVDWDG… |
| A0A7U4RD82 | 135-236 | None |
| A0A1V3WF40 | 3-90 | None |
| A0A0U1DYD7 | 22-129 | None |
| X8APJ5 | 2-91 | None |
| A0A7I7MXH9 | 98-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.