DPCstruct | MC30628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 70 ± 10 aa |
| Standard deviation of domain lengths | 9.60 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 41.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9BEX0 | 3-59 | FIVMEDLAYRYKCPCIMDIKMGRVTYDPSATKAKRLSEAIKYPEQETLGFRLTGYRV |
| A0A151MYU3 | 1-80 | MTYLASMLISYNQTDLYLKLEDVTCKFNKPCIMDVKIGQKSYDPYASAEKIHQQVSKYPLMEEIGFLVLGMRTYVSALFA |
| D2W5U4 | 161-233 | None |
| A0A183R8N4 | 172-249 | None |
| A0A0N4VH20 | 126-199 | None |
| A0A3P7P0G9 | 1-65 | None |
| A0A5J4UVF7 | 29-88 | None |
| A0A5J4NYW0 | 74-148 | None |
| A0A183HH79 | 1-54 | None |
| A0A183W7A4 | 67-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.