DPCstruct | MC30625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 113 ± 7 aa |
| Standard deviation of domain lengths | 7.25 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 44.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452EDW1 | 9-119 | WPVLVGKRFLSLSAADGSDGGHDSWDVERVAEWPWLSGTIRAVSHTDVTKKDLKVCVEFDGESWKKRRWIDVYSLLRRAFLVEHNLV… |
| A0A7R8D3B3 | 13-113 | RTDNVGKRFLCVSGSHKIKINRYTEWPWRAGVIRCSSHLDASDNELQFLVEFDDQPWESREWINVYTDNYHIFLVESQLSLGSRPSA… |
| A0A5E4Q4N8 | 9-111 | None |
| A0A0R4IDZ5 | 5-114 | None |
| Q15652 | 1-116 | None |
| A0A5A9PTN8 | 1-109 | None |
| A0A498M222 | 7-108 | None |
| Q6ZPY7 | 8-125 | None |
| A0A2Y9RLD8 | 213-328 | None |
| Q3UI14 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.