DPCstruct | MC30622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 166 ± 15 aa |
| Standard deviation of domain lengths | 14.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A416W011 | 130-292 | GDIALTSIDSLSVDMANGAAIKLSTPAGLKFQAKVSSNNGEAVKSDAIKEGMLITANDIYENNSSALDLTSPYAMLNIVNEGWFDES… |
| A0A353EZ94 | 492-669 | MKSGASVRIVFDETNSNGLRFTSMLHKNAKYKIYGTLIVKAADLGDNEFTMAALDAANIKYANIVADANGTVEGKDDKTYNAALVNL… |
| A0A2V2FSY3 | 955-1141 | None |
| A0A2V2G9J0 | 261-412 | None |
| A0A2V2GGY8 | 37-202 | None |
| A0A2V2GQ29 | 33-211 | None |
| A0A1V5TY13 | 741-921 | None |
| A0A3A9D4Z3 | 725-891 | None |
| A5Z870 | 182-332 | None |
| A0A357CVC7 | 71-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.