DPCstruct | MC3062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Standard deviation of domain lengths | 12.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02049 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078L0B7 | 1-104 | MSDVNTISLMNQMRLMSSKAAGSSVEFAGVQESFGEVFQNALNETNQLQQSADALKARFEVGDSNVGIGEVMIQTQKADIAFQATLS… |
| A0A2D4S4X3 | 27-131 | LEKSAADRLTEEVDKIQNQSANYPEVKADPNVPDFQTMFGNAINNVNKLQQTSGDLRTRFEKGDPMVDLPEVMIAAQKASVSFDAMK… |
| F3KWK6 | 18-104 | None |
| A0A143HN96 | 1-105 | None |
| Q6QJB6 | 58-144 | None |
| A0A811AJ24 | 1-113 | None |
| A0A1M7AMT5 | 67-179 | None |
| A0A3B1ALD5 | 2-111 | None |
| A0A7W9Z380 | 1-128 | None |
| A0A328Z1S0 | 16-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.