DPCstruct | MC30619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 9.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317NDB5 | 1-81 | MLADGVTDVYLATLSETYLLLIQTGEKNVAGKLAEMVDRTPSGVLQQLKRARKAELLTSIPGRAGGQLTPKAEEILTKDGD |
| A0A7I9ZIX6 | 74-164 | REFEREQLRTALREGITEAYLALLSWHYVQAAERGQANINNYLAEMLGKPVGTVRGHLIRARHDGLLSGSHGRKGGELSPEAQALIE… |
| A0A1A0MGW8 | 36-128 | None |
| A0A848K7I1 | 95-178 | None |
| A0A7K1B0H8 | 142-248 | None |
| A0A7Y8P3I0 | 45-121 | None |
| A0A2U9PLH0 | 60-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.