DPCstruct | MC30617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 153 ± 19 aa |
| Standard deviation of domain lengths | 18.58 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S6JJG6 | 2-119 | TVAAVDTAWTVERATRFLRSLTAGARRFAEMVIVDGDGYIDADQLRAAIGKLNGPTVALSRAVPRGVREGWWPEGISVPIAPVHDPD… |
| A0A495WQQ6 | 1-161 | MNGTLSIHGDLAVLSELALKIEEWFPGALEAAVESESWGGWTVDRMTILLERLHQWQLLLVSFVANAGGRRSDPEVRQKFSIGDNGL… |
| A0A418WZ01 | 55-229 | None |
| A0A3N4R3U2 | 23-160 | None |
| A0A2G7D0D3 | 24-165 | None |
| A0A2M9IT48 | 1-147 | None |
| A0A1X7F6P7 | 1-188 | None |
| A0A4P7LLL0 | 43-199 | None |
| A0A1H4S3C3 | 4-169 | None |
| A0A7Y0G5F5 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.