DPCstruct | MC30616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 84 ± 12 aa |
| Standard deviation of domain lengths | 11.55 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 55.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07904 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6WUZ0 | 126-217 | AAVCKELQQVEVELRLLEALEIYHPSKLLGMHRHFILYGLMEYLERRLNHHYTAEEILELLDRFYNLELLKPDEEELELLSQEEEFA… |
| A9RXA5 | 2-88 | GTQQVELELRLLEAFAIYRPSLLAGMHRHFILFGLMHHLERRLNQRFSPDEVLQLLDRFFNLDLLEPDDEELELVNHKEDFSLPQSI |
| A0A7S0R2T9 | 2-96 | None |
| A0A816VQN6 | 17-112 | None |
| M1DNA5 | 33-112 | None |
| T1LM84 | 6-92 | None |
| A0A7N0TRJ8 | 25-121 | None |
| A0A803RA99 | 33-99 | None |
| A0A388KI74 | 119-187 | None |
| A0A7J7NW41 | 32-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.