DPCstruct | MC30615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Standard deviation of domain lengths | 10.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 49.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9RWB8 | 1-82 | MGNKITRRRHVIDERYTRPQGLYPHRDVDQRKLRRLILESKLAPCFPGEEESATDLEECPICFLHYPSLNRSKCCTKGICTG |
| M5EEC2 | 57-139 | ISSKTRVDDGYVVRQGIYAARSDYDDQTVRKLIVERKLSPFFPGAEDEDDLPVTSVRSECPICFLYFPTALNHARCCLQPICT |
| A0A5N5KVN4 | 1-64 | None |
| A0A6U4KNC3 | 1-81 | None |
| A0A287XU73 | 29-109 | None |
| A0A7J7MND5 | 1-86 | None |
| A0A0E0ACN6 | 1-107 | None |
| A0A7J7QDG6 | 1-81 | None |
| A0A804HNW4 | 1-87 | None |
| A0A444D4V6 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.