DPCstruct | MC30611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 120 ± 15 aa |
| Standard deviation of domain lengths | 14.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 79.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9S4I0 | 19-126 | VQTKYKTVARKVKLVAIQLPVDNMEHIKQAVMEPSLRERCRIGHQFTQESLAKLKIGGGDFLTSTEEDMFQEMLIRYGKAFALTPDE… |
| A9RSC3 | 1-118 | MLESFQAPEVTVETRYKTADKKVKPVAGPLPEDSKEQMGEASKEASLRDPMSIGHQFIEETFEELKIGSDGSLLPEEITCFKKMLAK… |
| A9TA23 | 83-190 | None |
| A9SX97 | 1-118 | None |
| A9ST10 | 113-239 | None |
| A9SLU1 | 101-246 | None |
| A9SE86 | 235-378 | None |
| A9S950 | 86-190 | None |
| A9S6S2 | 56-165 | None |
| A9TM54 | 56-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.