DPCstruct | MC30610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 11.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 50.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11460 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S3JFK2 | 1-100 | MRRIDVIGIGIGMFAVGGILYIILQKTGLDSASAGIWSQAVLVGGVIGWIFTYLFRVATDNMTYGQQRKDYEDAVFKKRLEAMTPEE… |
| A9RRC6 | 1-108 | PFGYTRKDVILIGVGLTAFGVGLKYGLEFFGVDPLRAGNVVQIIMVAGLTIGWISSYVFRVSNKDMTYAKQLKDYENKVMEKRLEEL… |
| A0A7S3C150 | 35-149 | None |
| D8R0U6 | 52-180 | None |
| A0A0K9QQX5 | 91-199 | None |
| A0A7S2RAL7 | 13-118 | None |
| A0A6A6MA68 | 13-127 | None |
| A0A5A7UXD8 | 4-83 | None |
| A0A6U3QHR8 | 68-185 | None |
| A0A7S1NI43 | 112-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.