DPCstruct | MC30605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 119 ± 15 aa |
| Standard deviation of domain lengths | 14.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 65.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9RBZ3 | 6-119 | KKVYDLPGQKHDPPEERDALRIFYSTLREQIPESEMAEIWLMEHGLLSHAEAQKAFERKQKRGQSSKHGTISKPSTPSRVSNGSSGV… |
| A0A7J6LG64 | 100-228 | EEGETKDARRHFKEGQKHVTPPQGDSTRGFYESLLEEKPGSVMAIRYCVEHGIFAGEKHRKLLARYNELKASGDLNPNKRALDRVAE… |
| A0A6P8BZ66 | 41-147 | None |
| M8B0C4 | 221-328 | None |
| B7G3U0 | 2-102 | None |
| A0A0K9RD61 | 73-186 | None |
| A0A2K1KTF4 | 220-354 | None |
| A0A7R9T4R8 | 31-151 | None |
| A0A7S2RJJ4 | 1-115 | None |
| A0A484KEA8 | 153-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.