DPCstruct | MC30604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 78 ± 13 aa |
| Standard deviation of domain lengths | 12.52 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 67.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 50.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9RB81 | 9-78 | ELQLFPTSETQIHEHVNGTRRKLGVFRQCSPCTCCDKTRRWCLPTFCCYNILCGVQGLPYGLCSFIPISC |
| W9S703 | 41-119 | EEPPLVPLVEEGKMEMMMNESRRKLGSFQICALCTCCGGARGVCLPSPCCYAINCNIPHRPFGFCSFTPKTCNCFGCHL |
| H9W157 | 21-95 | None |
| A0A803KMR4 | 39-124 | None |
| A0A4Y7LED9 | 46-148 | None |
| A0A251SGN2 | 47-105 | None |
| A0A835H301 | 76-163 | None |
| A0A151U5P4 | 5-66 | None |
| A0A6A5MYQ5 | 25-91 | None |
| M1AUT5 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.