DPCstruct | MC30601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 242 ± 57 aa |
| Standard deviation of domain lengths | 57.02 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.75 |
| Pfam Score | 90.48 |
| Assigned Pfam label(s) | CL0659- PF04712 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V5B8B3 | 1-148 | MIIAVPETVRLAHFIQLHDAACTLVVRGQYVFTPSGSGVSKNTMFAGQPVRHAMKPSCYLRAFHPGKEERNRILYGPTYSSVTDRLS… |
| A0A507DST7 | 549-779 | QEKLDNIWLWGKILGVQRDYLVAQAIGNDAFARKFYYSIDLVNWLQLPEVLATDMDKMTQIHVRFSGDPAFEYTIAAESGEEGEETV… |
| C1MK86 | 43-315 | None |
| A0A672G256 | 93-365 | None |
| A0A662WVF1 | 238-513 | None |
| A0A816QG99 | 627-886 | None |
| A0A0R3TN08 | 1-218 | None |
| A0A6I8PM14 | 4-368 | None |
| A0A391NKF9 | 8-174 | None |
| A0A7S2CSS4 | 42-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.