DPCstruct | MC30600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 154 ± 13 aa |
| Standard deviation of domain lengths | 13.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D1YXR7 | 21-167 | PALKDRIEYTLWFFPEVINIKFGRASRSAYYDGGTGTVRLTKISSNYVIGHEITHFLQDEAHFNGKTLPKGERQCDLFLFARSPALV… |
| A0A850SCE5 | 2-152 | LRFTRVAEAGFSGDFKQKVLNVYSLFPELQDDEITCGFIRKGSRLLGTARGWSGQIALQPNVGRMTIAHELTHLLQGNGVPHGEKAC… |
| A0A2E8GED2 | 1-147 | None |
| A0A662HGP3 | 4-160 | None |
| A0A6G8TDP8 | 2-126 | None |
| A0A832IAX0 | 7-176 | None |
| A0A7J3ALW9 | 49-206 | None |
| A0A1I3MI90 | 20-192 | None |
| A0A2A4P494 | 99-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.