DPCstruct | MC306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 8.83 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P3QLM7 | 40-107 | ILTDQQLVEYAAGATGHPIASLELLQRSASGTVTSYKVKAKNNVTFHCVLNGGNILSMGIVNPPVCNQ |
| A0A5S4ENG9 | 1-78 | MAVTDNTLEQRTANATGMAVGSFTVTDRVDDGMTTRYLVKGKSGQTFNCYVTGTVSFLGRQVSDAQCNSLGRNERGTA |
| A0A220VFH6 | 22-89 | None |
| A0A5C7QLF1 | 1-78 | None |
| A0A1Y6BL60 | 12-101 | None |
| A0A5C7KJR8 | 16-94 | None |
| A0A0H5QDP8 | 48-133 | None |
| A0A2P5N4E0 | 10-81 | None |
| A0A0A7S2M0 | 27-109 | None |
| A0A429W7X4 | 41-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.