DPCstruct | MC30597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 160 ± 17 aa |
| Standard deviation of domain lengths | 17.23 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 26.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C6PMV0 | 4-131 | SVVLVMIILLCYLAHLHKDIENKKKYINALKEINETSIKRLKGEWKSFKDSGEEFIDENHNYSYDLDIFGKGSLFQWINTCRTYIGR… |
| E1KU30 | 10-194 | MNHDLNKLYSSRITELSNTIGRLRTKSRGFIVSEIVSFGVAIGFVVLFTILENASWTLGAALCALFSYFYIRNLDTKNDKKIAEAEA… |
| A0A090Q1F9 | 2-155 | None |
| R6WIY1 | 4-157 | None |
| A0A800IPI9 | 7-191 | None |
| A0A1Q9GSJ3 | 2-178 | None |
| A0A3B8ZM46 | 2-154 | None |
| A0A090QB43 | 2-174 | None |
| A0A5C1IJ51 | 1-160 | None |
| A0A5J4R8J6 | 2-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.