DPCstruct | MC30596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 121 ± 11 aa |
| Standard deviation of domain lengths | 10.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E1KTY8 | 5-116 | NNDNYVLVLEDRTEVKNEKEAGKLSVVSGIDDKGNLKTTEAIAANQAAFLKFNNKDGLLKNFMTNFLKQFNNPTHFGLYKVLASNVE… |
| A0A5N7Z989 | 7-114 | DQQEVLLVKNGKGKKLEVVTGIDEKNGKLKTAPPEQENQNEFLKINKHENALENFFSNFLRQVKNPTQFRFFKLPLLKIKAVSQLED… |
| A0A641W909 | 15-122 | None |
| A0A5B2U9A2 | 14-130 | None |
| A0A854FU61 | 5-135 | None |
| A0A060REK7 | 2-136 | None |
| C2FXH2 | 15-115 | None |
| A0A2X2K4E4 | 6-121 | None |
| A0A4R5CM02 | 13-117 | None |
| A0A7K1HW40 | 10-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.