DPCstruct | MC30594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 263 ± 75 aa |
| Standard deviation of domain lengths | 75.36 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 85.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08907 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378VZI8 | 12-190 | LTSQPVRDLASLLTAPPLWQSGCELSVRELLGERGFRYLLALDADPAPLTDYLAQRAPFDHRLGIYAEELLAFWFTNAPHTKLHAYN… |
| B5JXV4 | 5-242 | RSAKLVIADVRWLLSSPLLWVAEGDEGIENLRSASLSRVSAALDDLALAPIEALVDRVGAPPKSHKLGDYFEWLVQLWLSLDPTLHR… |
| A0A7S1F755 | 64-489 | None |
| A0A6A3HYK0 | 17-376 | None |
| A0A3T0K806 | 12-200 | None |
| A0A1X1QK52 | 3-220 | None |
| A0A0B8PEM7 | 1-135 | None |
| A0A2G6CZZ9 | 46-416 | None |
| A0A7Y7CVF5 | 2-224 | None |
| A0A7U8C1B1 | 2-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.