DPCstruct | MC3059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 112 ± 20 aa |
| Standard deviation of domain lengths | 19.69 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E0VID8 | 152-239 | SLSPVSCYSQKLLRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACNSQVTRLCDLSSDGNSVTSVA |
| A0A0B2RKC9 | 4-89 | LRILAFKNKPSKPVDLLHPQISTLIRQNKPAKPRRVIPQTLDAPELVDDYYLNLWGSNNCSCIALGSIMYFWDAKNHSTSELVTID |
| A0A6G1DRT4 | 67-172 | None |
| E4ZTZ3 | 394-516 | None |
| A0A1Y3BVV8 | 131-247 | None |
| A0A6A5DKA8 | 143-251 | None |
| A0A2I0HIP5 | 39-173 | None |
| A0A5N5IE29 | 1-64 | None |
| A0A482VXN1 | 1-90 | None |
| A0A662X1V8 | 64-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.