DPCstruct | MC30589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 106 ± 10 aa |
| Standard deviation of domain lengths | 9.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 61.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6EK49 | 115-216 | FKDSLKALEADMQHANTLALDYPRDKDGARLQMRLSYSSVAHLFLFLVQWTDCQLAGMLGLLRIHIYMTFADGKTTMSVYERKASIK… |
| A0A0V0IDQ2 | 4-111 | SFKDSLKVLEADIQHANTLASDFPREYDGACLQMRMSYSPAAHLFLFLVQWTDCHLAGALGLLRILIYKVYVDGTTTMSVHERKASI… |
| A0A1D6EL31 | 118-227 | None |
| A0A287F5N2 | 1-91 | None |
| A0A7J6DSB9 | 9-123 | None |
| A0A2P5WWF5 | 6-126 | None |
| A0A6J1KIH2 | 117-239 | None |
| A0A1R3I1T6 | 2-108 | None |
| A0A0A9DPV1 | 7-106 | None |
| M8CJ28 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.