DPCstruct | MC30587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 336 |
|---|---|
| Mean domain length (aa) | 253 ± 60 aa |
| Standard deviation of domain lengths | 60.17 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 84.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.64 |
| Pfam Score | 99.67 |
| Assigned Pfam label(s) | CL0613- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2RS02 | 6-192 | FQTRYETYRTAVESYLETLFAGRPDWRDLYESMRYSLLAGGKRIRPVLTLEFARLAGLADWKTALPMACALELVHTYSLIHDDLPCM… |
| A0A0V0IB10 | 19-286 | LVFLVSRATAEMSGLKELTTKHRRLAEIIEMIHTASLIHDDVLDESDTRRGKETVHQLYGTRVAVLAGDFMFAQSSWYLANLENLEV… |
| A0A346AEG5 | 19-276 | None |
| A0A3R8P4M1 | 7-219 | None |
| A0A1A9UNP7 | 1-213 | None |
| A0A1A9UIV1 | 2-161 | None |
| A0A7J9RLX6 | 31-333 | None |
| I1CLB2 | 917-1198 | None |
| F4L611 | 24-400 | None |
| A0A226F1G2 | 331-637 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.