DPCstruct | MC30580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 205 ± 21 aa |
| Standard deviation of domain lengths | 20.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 63.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7JLJ3 | 1-158 | MSLLIDQVVAAPLQQDAAMVEKSDLPDHKMFSNGIPSEGCSGYAGFLEPDEVSLAFIKASFYQLYRGTQKIQLLHKDILLQLCCSKL… |
| A0A0V0HPC7 | 1-226 | MNLEVLKYCATVLFMESSLPDIFTENSWVSPNAITRSRTIGRATPEKTDFSADTPSPSIKIESHVESTEEINPFNMGELEESLLSEV… |
| A0A287QK78 | 1-202 | None |
| B9RLV7 | 176-367 | None |
| A0A453JWE3 | 44-267 | None |
| B4FMU1 | 83-287 | None |
| A0A7J0H3A3 | 5-225 | None |
| A0A1S4AZ07 | 6-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.