DPCstruct | MC30578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 112 ± 8 aa |
| Standard deviation of domain lengths | 7.82 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 44.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0023- PF18052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2X3I1 | 1-106 | MAYASIASLVRTMELLLTSDSPMLSLAFCHRKEIVALHKKVSSIEAFLKNSEKKICNYGAMTDLEARIKGFANAAEDKIEFGLREAM… |
| A0A0V0HF08 | 1-106 | MAYASLISLMTTIKSLLMTSNSPMQSLICDHREELWAIHEKVSSLAVFLNNFEKNNVSGEMTFLEVQVKEIASAVEYTIQLRLTEIE… |
| A0A2G3BNM1 | 1-106 | None |
| A0A2G3BNK3 | 214-317 | None |
| A0A2G3BN43 | 1-105 | None |
| A0A1S3Z810 | 1-101 | None |
| A0A2G2X3N7 | 50-166 | None |
| A0A2G2YZH3 | 273-394 | None |
| K4DEQ2 | 1-109 | None |
| A0A2G2W315 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.