DPCstruct | MC30571
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 12 aa |
| Standard deviation of domain lengths | 12.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0747 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0F426 | 1-112 | MKYTEIMVRYGELSTKGKNRKTFIMQLAQNVKRALADFPALKIHADRDRMHILLNGEDSEEVIPKLSKVFGIQNFSPSIRIEKEMPA… |
| K1SDZ3 | 2-115 | FTSFLIKYAEIGIKGKNRYLFEDALVRQIKYALKKCEGEFLVHKTQGRIFVDAESEFDYDEVVAHLQRVFGISGICPVVHVQDEGFE… |
| W7DIX0 | 2-120 | None |
| A0A832V1G1 | 2-85 | None |
| A0A380DWD6 | 1-81 | None |
| A0A1Q6Q9M8 | 1-100 | None |
| A0A2V8FVD5 | 2-115 | None |
| A0A0F5EUE9 | 1-101 | None |
| A0A663BJJ7 | 2-107 | None |
| A0A2N1UPW8 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.