DPCstruct | MC30569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 93 ± 14 aa |
| Standard deviation of domain lengths | 13.67 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E4LH82 | 1-83 | MLEFKFDVQLLIAGQQLSEDAIYEHIAQHFEGDSLLVMGDEDLIKLHFHTNAPWQVLEYCASLGDIHDIVLENMQRQEQGLQG |
| K1S2M0 | 43-138 | MGIQSIDAEDDQFAYRYDTQLLIERRDRDLDEDEISDYITEHFEGNSLIAAGDEDLIKIHFHTNEPWKILEYCSSVGEIFDIVVEDM… |
| A0A2N1PWG0 | 61-166 | None |
| R6FYB8 | 1-96 | None |
| A0A7V3ERG1 | 9-131 | None |
| A0A536IQK1 | 203-286 | None |
| A0A1A9X9T2 | 5-88 | None |
| J9FZ84 | 128-220 | None |
| A0A7E4S0B7 | 748-835 | None |
| A0A0S2ZLB8 | 233-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.