DPCstruct | MC30562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 81 ± 5 aa |
| Standard deviation of domain lengths | 5.48 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5LZJ1 | 1-79 | MELTQEDYIIICGDFGLCWAKDKTFEYHCKNFAEKPYTILWVQGNHENYDMIGEYPLEEWHGGKVRHIIRDKVILLERG |
| A0A2V2CWM0 | 72-150 | TRRKDVLIILGDSGFNYYEDARDDKLKAEISRLQITLLCLHGNKECRPERIGTYGVRNFCGGRVYYEPKYPNLYFAIDG |
| A0A1Q6RQJ4 | 65-152 | None |
| A0A1X1Q4M6 | 1-71 | None |
| A0A7Y6BUY1 | 26-104 | None |
| A0A0K8J649 | 35-111 | None |
| A0A412QAP6 | 23-104 | None |
| A6TJV9 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.