DPCstruct | MC30561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 111 ± 3 aa |
| Standard deviation of domain lengths | 2.72 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 92.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316QBY8 | 1-112 | MRKFENCDVLAVLHEIMLHNTKHFQEDFVVDEEILREAAEESNSLDRRYLWMSRPCGTHCLKEKDVFLYNSPEYSTWTAYADTADKI… |
| A0A7X5E4R3 | 1-112 | MRKYENVDIIASLGAVMELNTEHYKSDFRYDMEMFMEAARHPTEENTHLLWLSRRCGTECFRERDVYLKESQASHTWAFHATTGDSI… |
| R9J564 | 1-113 | None |
| U2QWH3 | 1-113 | None |
| A0A6N7XMY4 | 1-105 | None |
| A0A6N8HXI6 | 3-112 | None |
| A0A6I2RLT8 | 1-106 | None |
| A0A1C5W4Q6 | 1-113 | None |
| V2ZIV9 | 2-111 | None |
| A0A7S7EUG6 | 120-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.