DPCstruct | MC30560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 73 ± 9 aa |
| Standard deviation of domain lengths | 8.90 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5LDR0 | 70-134 | VEKPKCKLVGEDGNIYNLMGIASRALKKNGLEEEAKEMFNKITTEAKSYNEALCIIMDYVDVTGE |
| K1RA84 | 52-119 | FKKEIEKPLVPIIGADGNVFNLIGICSRALKTAGYPDKAKEMTDRITSSGSYDEALSIMCEYIEPVNQ |
| A0A448W9G9 | 40-128 | None |
| A0A1V5GJ76 | 2-73 | None |
| A0A6G7ZC87 | 1-79 | None |
| A0A0S8FZH5 | 8-75 | None |
| A0A1H7QA84 | 53-134 | None |
| A0A372SKW2 | 470-539 | None |
| A0A3E2VZK9 | 115-201 | None |
| A0A372WI67 | 152-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.