DPCstruct | MC3056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 141 ± 15 aa |
| Standard deviation of domain lengths | 15.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 48.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6LVP4 | 141-264 | SEERGWCLLHDYILRSELCCGLELEERHLEAIARLSSLMISRPVDSSLTSHQDALQRCIEHANNWICKSEKKIDPNSEFTYADVREM… |
| A0A0B2R509 | 60-200 | TARRTDDATDLLGEKDLDSISALRGLLVSRPADSSFSHKNALHRCVEHAKLWLAKSEQPIGPDADVTYAALREKLNKIMSSEYFTTT… |
| A0A6A4P5H8 | 2-149 | None |
| A0A1E5VQS4 | 4-152 | None |
| A0A816UKD0 | 4-149 | None |
| A0A5A7QQA5 | 155-273 | None |
| A0A830BVW3 | 14-169 | None |
| A0A7J9K7T5 | 82-227 | None |
| A0A6A6LHT4 | 165-302 | None |
| A0A0A9D3T6 | 139-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.