DPCstruct | MC30559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 139 ± 20 aa |
| Standard deviation of domain lengths | 19.80 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D8SLD4 | 3-135 | NRIQRMQIHVLPFTDHQGHAAGLVFRGRASCPLPPLYALAIYFTHPDASSDNVDPAALFTAINQPSGTHEIRLELYFLPHATVSDCI… |
| G2Q4L6 | 48-202 | PRAPRKQLPGPCPPEKVVVEPAPSHDGAPTFAAYSVPLPELQADPDSDDGYGNSPPATEPEKHRPKFGIRLYDTTADATAERAAMLA… |
| A0A0U5GKY7 | 541-653 | None |
| A0A0U5FS41 | 276-417 | None |
| A0A066XL83 | 1-161 | None |
| A0A6A6SCZ5 | 1-152 | None |
| E3QTF9 | 31-187 | None |
| R8BGM1 | 4-133 | None |
| A0A2S7PS88 | 129-260 | None |
| A0A3M2TC06 | 9-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.