DPCstruct | MC30557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 102 ± 9 aa |
| Standard deviation of domain lengths | 8.82 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4T0WAI6 | 342-447 | RLVLLTRFSERGFADVLGLTGDPVMLAMRKVEIAGDLLDAVSDMPFEALQANGEPCVEKLRQIGVALLEIIHNVSSEVISARARSLF… |
| A0A4Q2V355 | 1-99 | MAEVVGLSADPLALAMRQIELAQDFLDALENMPFLHLQAEGEHCVEKIRRVGSLLLELAHNAQNDAVKSQANQCAMRLIDMLAHLDS… |
| A0A428NJ82 | 988-1092 | None |
| A0A4Q4N5W5 | 126-236 | None |
| A0A428NN25 | 1-113 | None |
| A0A3M2SDN3 | 101-190 | None |
| A0A4S9ZJN4 | 179-286 | None |
| A0A428TIC5 | 140-231 | None |
| A0A444RS66 | 2-87 | None |
| C7YKZ3 | 465-569 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.