DPCstruct | MC30554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 4.82 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09834 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1N7J010 | 22-86 | MTKTISFAIMHFAIAFSVAYALSGSFIVGGAIAIVEPAINTVGYYFHEKIWARRHVAAQAFDINQ |
| A0A2E7K1S1 | 1-58 | MSRNVAKTLTYGVMHFAVATGVAFAMTGSLAIAIGIGLIEPLVQTFCYAFHEHIWNKV |
| A0A7U0SE98 | 1-64 | None |
| F5XWX5 | 5-76 | None |
| A0A0B3BX09 | 2-60 | None |
| A0A7W2QLL4 | 8-72 | None |
| A0A1H7FKH2 | 2-65 | None |
| A0A6N1DQ97 | 2-62 | None |
| A0A2E0QCV0 | 1-64 | None |
| A0A1I0HIZ1 | 20-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.