DPCstruct | MC30551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 172 ± 35 aa |
| Standard deviation of domain lengths | 34.63 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0458 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B5VJZ4 | 2-106 | EEPKPSENLQPTPRKKAIKLTELGPRLTLKLVKIEEGICSGKVLHHEFVQKSSEEIKALEKRHAAKMRLKEQRKKEQEENIAKKKAV… |
| A0A3P7XDR2 | 30-199 | LSKSTKKLIQSKVPDLSKYKNIEDYFLNPGQISESEYEFEQKEVELPQQLTTRGCLEGQKTNIRLYELGPRLTLQLMKIEEGVDEGE… |
| A0A0B7NJY1 | 562-733 | None |
| A0A7S1T523 | 28-186 | None |
| A0A7T8JYS7 | 67-224 | None |
| A0A498LG62 | 188-357 | None |
| A0A5N5TK89 | 67-249 | None |
| A0A7R9M1B6 | 7-133 | None |
| A0A0D2PEI3 | 72-264 | None |
| A0A154P4Y9 | 693-914 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.