DPCstruct | MC3055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 245 ± 36 aa |
| Standard deviation of domain lengths | 36.13 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 47.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453HPX1 | 4-225 | RMILSKEEMEEVVMKRCWLARYWGLAVQYGIYPDISMSKYEYWSSFAPLPLEYVTSAGLRAKDGGSNELEETDMLVHDLTVTAGEGN… |
| A0A0B2R4N2 | 88-359 | SKDGVDKEITSLQAEIENAKVETEAAVRQLNGAESEVKALRSMTQRMILTQKEMEEVVLKRCWLARYWGLAAKYGICADVAVSKYEL… |
| A0A6P6FXD9 | 417-708 | None |
| A0A835RFY4 | 4-271 | None |
| A0A6A2YXH7 | 128-392 | None |
| A0A5B8MVL8 | 49-357 | None |
| A0A5J5BTF9 | 143-364 | None |
| A0A452XZG3 | 10-249 | None |
| A0A061E405 | 264-473 | None |
| A0A443P862 | 247-462 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.