DPCstruct | MC30545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 8.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0032 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380P2V0 | 4-110 | YRRFLKDFTTVLDETKGFRYFEGRAIIGFIDGTEAPEVQDAAEYAIIGDEDPEFINGSYAFAQKWIHDMDFWNNQATETQEKAVGRE… |
| A0A143I534 | 107-223 | FSVAQAAVAAFGDSIEVQEEVHGFRWVEERDLSGFVDGTENPAGEETRRDVAVIKDGVDAGGSYVFVQRWEHNLKQLNRMSVHDQEM… |
| A0A7K2EDE5 | 1-99 | None |
| A0A4S2L7R5 | 173-284 | None |
| A0A6J8EWG9 | 154-245 | None |
| A0A657ITR7 | 93-201 | None |
| A0A8B3HHE9 | 5-100 | None |
| A0A533QLJ9 | 18-122 | None |
| A0A183MPQ9 | 227-339 | None |
| A0A379FIX4 | 1-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.