DPCstruct | MC30544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 86 ± 5 aa |
| Standard deviation of domain lengths | 4.52 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 57.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2VKE3 | 793-880 | TEDNHPMHIHLGLFVVLEQRELVNVEEFKGCMLKFNDAIKCKVDKYSIGKKKEVVLHEKGWKNVYKMMPGHVTKILVKFSFIHSNESY |
| A0A0D3EJ52 | 1082-1169 | LTGDNHPLHIHLGMFQAVKMQQLVNLQAFTDCMTAVNDAVKCNVDQHAVGPVVPVPDHEKTWKNVIKVPPGFVTSVVIAFKLVDTNQT |
| A0A0D9Y2Q1 | 713-789 | None |
| A0A0D3EJ56 | 351-438 | None |
| A0A0E0BWE2 | 1074-1162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.