DPCstruct | MC30543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 140 ± 18 aa |
| Standard deviation of domain lengths | 17.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 64.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 45.56 |
| Pfam Score | 97.15 |
| Assigned Pfam label(s) | PF08880- PF08879 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804HUE6 | 4-141 | MVVGGGSRYPFTASQWQELELQALIFKYMVSGIPVPPDLILCIRRSLFVEPQTLPFLPHRPTVGWEAYQVGDGRKAVDPEPGRCRRT… |
| A9TWB7 | 1-108 | TTSQWAELEHQALIFKYMMAGVNVPQELLNPIRKSVATMNSLSSHHTTNPFHLGVPNNTDPEPGRCRRTDGKKWRCARDVVPDQKYC… |
| A0A836DHX1 | 24-175 | None |
| A0A7D5UN47 | 104-240 | None |
| A0A5D2LCX4 | 56-202 | None |
| A0A1R3JPF3 | 5-151 | None |
| A0A2I0HWT7 | 117-232 | None |
| A0A5P1FEJ7 | 5-136 | None |
| A0A836DIH0 | 2-153 | None |
| A0A444C395 | 84-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.