DPCstruct | MC30542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 131 ± 26 aa |
| Standard deviation of domain lengths | 25.80 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 68.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 51.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804HU35 | 4-108 | LREKHGHQQKGSSSGDGDFGHFRGHLLFEFLEQDPPFIREPLSDKISDLARCFPALKSLRSCDLLPSSWISVAWYPIYRIPNGPTLK… |
| A0A6A6K3U5 | 30-103 | FQYFERSTPYGRVPLMDKINGLAQRYPGLMSLRSVDLSPASWMAVAWYPIYHIPMGRTIKDLSTCFLTYHTLSS |
| A0A287FC07 | 1-122 | None |
| D7LLQ5 | 86-189 | None |
| A0A6P5T5Q8 | 102-233 | None |
| A0A2J6JQT7 | 159-334 | None |
| A0A7J8XEB3 | 32-185 | None |
| A0A453ESH8 | 123-258 | None |
| A0A6D2I6U0 | 157-311 | None |
| A0A453ESI7 | 34-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.