DPCstruct | MC30540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 211 ± 23 aa |
| Standard deviation of domain lengths | 23.11 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 67.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7GDE4 | 7-231 | TMPSHRRYCSYGHPSHVCYEQYALEVPLVHVISLRIAFFLFMKMMQNSGRVVMMKTKLGKGNPVWVDDKEEKVSINIAKVNRLRKLR… |
| A0A453M2H3 | 1-197 | TPRWSSAPRLGLPCRPVARVMLPCSSWTGLPATTCLFMRRTWAVRMRKLRKEADERVISGKEYEARLRGHHAKLNPFTGWADMDRKA… |
| A0A4S8LSV5 | 90-326 | None |
| A0A7J7GIR7 | 29-212 | None |
| F2SJR2 | 79-307 | None |
| A0A4U7AYN6 | 489-706 | None |
| A0A4D8XQR2 | 271-497 | None |
| B3RXX8 | 14-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.