DPCstruct | MC3054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 63 ± 8 aa |
| Standard deviation of domain lengths | 8.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 85.21 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0020- PF00223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453JFQ9 | 49-112 | GNYAEALQNYYEATRVEIDPYDRSYILYNIGLIHTSNREHTKALEYYFQALERNPFLPQAFNNM |
| A0A0B2QVF1 | 7-70 | GNYAEALQNYYEAMRLEIDPYDRSYILYNIGLIHTSNGKHTKALKYYFRALERNPSLPQAFNNM |
| A0A444XLH3 | 3-57 | None |
| A0A4D6M3U4 | 210-285 | None |
| A0A7J7L6X1 | 6-82 | None |
| A0A2J6JWT7 | 79-150 | None |
| A0A0E0R1N3 | 45-99 | None |
| A0A4S8I311 | 7-70 | None |
| T1MJU8 | 2-54 | None |
| T1NWF7 | 1-55 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.