DPCstruct | MC30533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 154 ± 21 aa |
| Standard deviation of domain lengths | 20.84 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 44.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446JSJ2 | 1-138 | MSLDRSFSTSAALSRLLARCPALGADPCLLALASAPAAPTWDDVAAALAEPLFHPRYTVPIIGCFRPLAPALVDHASELLRTAAPAL… |
| A0A7J7FVV9 | 1-162 | MAIDGSSRLEFELKRFLSRFPKLASVSRLNSLLKEGHSLTEEEMVSALAELFLHPNYTIPLMGCFRCIAQQIVERAVALLHLVPDLR… |
| A0A2J6JN98 | 1-170 | None |
| A0A2I0XHF3 | 136-289 | None |
| A0A1S3ZDE3 | 1-176 | None |
| A0A2G2WZF4 | 1-171 | None |
| A0A7N2KQT8 | 1-157 | None |
| A0A5D3BYG4 | 1-161 | None |
| A0A452YC12 | 2-129 | None |
| A0A444FCR8 | 1-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.