DPCstruct | MC30530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 473 ± 41 aa |
| Standard deviation of domain lengths | 41.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212MAF4 | 1-529 | MRLLETLKAKSAARQLQNPFKAKSEDQLARQSDEGDFDKGTLAAHYLPDDYSFKSVPVATYNTVRPLLALLKAHESKRYYEHVFDPS… |
| A0A4V3XIP5 | 2-393 | RSMLQLIASHDQKIYFSGPLIRRVERQPNGQKPADNKGWRDSRGQLEGTTLALWDVKEIEEAREQGRQAYPQYINIADAFVHLMGTH… |
| A0A1Y2GF58 | 203-682 | None |
| A0A1E3QVK1 | 34-513 | None |
| A0A6H0XM88 | 419-880 | None |
| G1XQK5 | 1-447 | None |
| A0A1X7QZR0 | 1-468 | None |
| A0A1D2VCP1 | 153-679 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.