DPCstruct | MC30529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 107 ± 9 aa |
| Standard deviation of domain lengths | 9.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01899 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4XC95 | 24-134 | LPAWGGLRLIRRLPRVFLYLFYLFGQVVVSNLQVMERILFPQKRKGGGRLVWFRTDLKEEGTRLTLANSITLTPGTVTVSLKGNYLC… |
| A0A1B1NBW2 | 6-110 | RAAVYGGWLAGEVIRGALRIGADVVTPGLRMSPAIVELPLHCETDLEISTMASSITITPGTITVGIAPRTGHAPPTLYVHAIYGHDR… |
| A0A0F6TBH1 | 3-115 | None |
| A0A0W8F8V5 | 18-127 | None |
| A0A1G3QYW8 | 117-218 | None |
| A0A7C3EE49 | 104-215 | None |
| A0A651EBL1 | 47-153 | None |
| A0A897MZV8 | 177-282 | None |
| A0A858PYU4 | 41-181 | None |
| K6W7R5 | 54-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.