DPCstruct | MC30522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 62 ± 2 aa |
| Standard deviation of domain lengths | 2.24 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 68.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01139 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820ILC6 | 1-64 | KGVIPMNAKDLEEALEMGRDGSLREGYSWAEDKEHCEEYGRMLQADPTKVSQRAKKRGLPQVTH |
| X1L4A2 | 103-164 | SSLKLPFHELKKVLRDGVSWAIKRGYGLPEDLERTEEYGKMEGADPEKVSQQALKRGKNQLG |
| A0A0K0EKR2 | 1035-1095 | None |
| A0A834FQ40 | 181-241 | None |
| A0A674BA23 | 158-218 | None |
| S9XQI5 | 547-607 | None |
| A0A443RQ14 | 507-567 | None |
| U6MEF7 | 96-156 | None |
| A0A1S4EKI4 | 27-95 | None |
| A0A2H1C621 | 60-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.