DPCstruct | MC30521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 198 ± 30 aa |
| Standard deviation of domain lengths | 30.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820I2H0 | 5-176 | YTPQSHSDSPKAVLRHNKADRTYYPQESISSENSRSSSQWHMNLEENADVFVKNSSSKYDAEMKTLCKNLMENQNVNLNECREYDKK… |
| A0A402EWW3 | 1-158 | MDYNSHGLMGIDYDSVWSPKETVRRLRRGKVCSLERFHSLQEKLLLLDEAVAGHDGNVIAAVLVFLKRTLKKEVLFRELELRQVALH… |
| A0A1I8AKW0 | 117-331 | None |
| A0A813LWN5 | 127-360 | None |
| T1L4L1 | 1-218 | None |
| A0A6I9YHY1 | 93-244 | None |
| A0A3P9KTP0 | 286-421 | None |
| A0A218VEL3 | 87-245 | None |
| A0A182EQU0 | 31-215 | None |
| A0A6V7UJ49 | 91-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.